Diabetes and Insulin Related
  Galanins

 Product Size Catalog # US$
Biotin-Galanin, human
Biotin-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
0.5 mg 23582 $181
Biotin-Galanin, human
Biotin-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg 23583 $303
Galanin (1-13)-Bradykinin (2-9), amide, M35
GWTLNSAGYLLGPPPGFSPFR-NH2
1 mg 22439 $165
Galanin (1-13)-Pro-Pro-(Ala-Leu)2-Ala, amide
GWTLNSAGYLLGPPPALALA-NH2
0.5 mg 22440 $121
Galanin (1-13)-Substance P (5-11), amide, Galantide
GWTLNSAGYLLGPQQFFGLM-NH2
1 mg 22445 $165
Galanin Like Peptide, GALP (41-60), human, porcine, rat
ILDLWKAIDGLPYSRSPRMT
1 mg 61848 $121
Galanin, human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
0.5 mg 22430 $137
Galanin, human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg 22431 $237
Galanin, human, FAM-labeled
FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg 23603 $423
Galanin, rat
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
0.5 mg 22434 $154
Galanin, rat
GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
1 mg 22435 $275
Galanin-Lys(Biotin), human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
0.5 mg 23638 $253
Galanin-Lys(Biotin), human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
1 mg 23639 $423
Galanin-Lys(Biotin), human, FAM-labeled
FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
0.5 mg 23620 $253
Galanin-Lys(Biotin), human, FAM-labeled
FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin)
1 mg 23621 $423
  < Back