Diabetes and Insulin Related
  Gastrins

 Product Size Catalog # US$
Big Gastrin-1, human
Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
0.5 mg 20747 $259
Biotin-Gastrin (1-17)
Biotin-EGPWLEEEEEAYGWMDF-NH2
1 mg 60329-1 $143
Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
0.5 mg 24213 $115
Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
1 mg 24214 $193
Gastrin-1, human
Pyr-GPWLEEEEEAYGWMDF-NH2
1 mg 20750 $127
Gastrin-1, rat
Pyr-RPPMEEEEEAYGWMDF-NH2
1 mg 20752 $127
Xenin
MLTKFETKSARVKGLSFHPKRPWIL
0.5 mg 60753 $110
  < Back