Diabetes and Insulin Related
  Glucagon-Like Peptides

 Product Size Catalog # US$
Biotin-Glucagon (1-29), bovine, human, porcine
Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg AS-60274-05 $143
Biotin-Glucagon (1-29), bovine, human, porcine
Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg AS-60274-1 $242
Biotin-Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human
Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
0.5 mg AS-23586 $198
GLP-1(9-36), amide, human
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
1 mg AS-65070 $203
Glucagon (1-18)
HSQGTFTSDYSKYLDSRR
1 mg AS-64344-1 $110
Glucagon (1-29), bovine, human, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg AS-22456 $71
Glucagon (1-29), bovine, human, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg AS-22457 $127
Glucagon (1-29), bovine, human, porcine, FAM-labeled
FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg AS-60273-05 $143
Glucagon (1-29), bovine, human, porcine, FAM-labeled
FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg AS-60273-1 $242
Glucagon (1-37), Oxyntomodulin, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
1 mg AS-22455 $665
Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
0.5 mg AS-22462 $127
Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
1 mg AS-22463 $231
Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
0.5 mg AS-23642 $275
Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
1 mg AS-23643 $457
Glucagon-Like Peptide 1, GLP-1 (7-37)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
0.5 mg AS-20761 $154
Glucagon-Like Peptide 1, GLP-1 (7-37)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
1 mg AS-20762 $275
Glucagon-Like Peptide 1, GLP-1 amide, human
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
0.5 mg AS-22460 $181
Glucagon-Like Peptide 1, GLP-1 amide, human
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
1 mg AS-22461 $335
Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled
FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
0.5 mg AS-23606 $291
Glucagon-Like Peptide 1, GLP-1 amide, human, FAM-labeled
FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
1 mg AS-23607 $484
  < Back