Diabetes and Insulin Related
  Beta-Amyloid (1-40) and Related Peptides

 Product Size Catalog # US$
[Gln11]-beta-Amyloid (1-40), Human
DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 24237 $181
[Gln22]-beta-Amyloid (1-40), Dutch Mutation, Human
DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
0.5 mg 61261 $181
[Gly22]-beta-Amyloid (1-40), Arctic Mutation, Human
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
0.5 mg 61262 $181
[Nle35]-beta-Amyloid (1-40), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-Nle-VGGVV
0.5 mg 23521 $181
[Pyr11]-beta-Amyloid (11-40), Human
Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 29904-01 $77
[Pyr11]-beta-Amyloid (11-40), Human
Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 29904-1 $385
[Pyr3]-beta-Amyloid (3-40), Human
Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 29906-01 $77
[Pyr3]-beta-Amyloid (3-40), Human
Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 29906-1 $385
Beta-Amyloid (1-40) • HCl, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV • HCl
0.5 mg 23211 $181
Beta-Amyloid (1-40) • HCl, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
1 mg 20698 $291
Beta-Amyloid (1-40) • HFIP, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 64128-1 $303
Beta-Amyloid (1-40), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 24236 $220
Beta-Amyloid (1-40), AMCA-LC-labeled, Human
AMCA-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 60487-01 $181
Beta-Amyloid (1-40), FAM-labeled, Human
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 23514-01 $132
Beta-Amyloid (1-40), FAM-labeled, Human
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 23513-05 $484
Beta-Amyloid (1-40), HiLyte™ Fluor 488-labeled, Human
HiLyte™ Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 60491-01 $220
Beta-Amyloid (1-40), HiLyte™ Fluor 555-labeled, Human
HiLyte™ Fluor 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 60492-01 $220
Beta-Amyloid (1-40), Rhodamine Green-labeled, Human
Rhodamine Green-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 61134 $115
Beta-Amyloid (1-40), TAMRA-labeled, Human
TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 60488-01 $220
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
0.1 mg 61483-01 $165
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
0.5 mg 61483-05 $545
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, FAM-labeled, Human
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
0.1 mg 23597-01 $237
Beta-Amyloid (1-40)-Lys(Biotin)-NH2, FAM-labeled, Human
FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
0.5 mg 23596 $787
Beta-Amyloid (1-40)-Lys(Biotin-LC), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin-LC)
0.1 mg 23518-01 $176
Beta-Amyloid (1-40)-Lys(Biotin-LC), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin-LC)
0.5 mg 23517 $583
Beta-Amyloid (11-40), Human
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 60017-01 $77
Beta-Amyloid (11-40), Human
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 60017-1 $385
Beta-Amyloid (2-40), Human
AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 29905-01 $77
Beta-Amyloid (2-40), Human
AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 29905-1 $385
Beta-Amyloid (4-40), Human
FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 29902-01 $83
Beta-Amyloid (4-40), Human
FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 29902-1 $423
Beta-Amyloid (40-1) • HCl, Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD • HCl
1 mg 21797 $374
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
0.5 mg 22817 $193
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
1 mg 22818 $325
Beta-Amyloid Peptide (1-40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 25380 $264
Beta-Amyloid Peptide (1-40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 25230 $423
Biotin-beta-Amyloid (1-40), Human
Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 23512-01 $110
Biotin-beta-Amyloid (1-40), Human
Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 23512 $583
Biotin-beta-Amyloid (17-40), Human, mouse/rat
Biotin-LVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 23541-01 $115
Biotin-beta-Amyloid (17-40), Human, mouse/rat
Biotin-LVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 23540 $385
Biotin-beta-Amyloid (17-40), Human, mouse/rat
Biotin-LVFFAEDVGSNKGAIIGLMVGGVV
1 mg 23541 $616
Biotin-LC-beta-Amyloid (1-40), Human
Biotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.1 mg 24645-01 $110
Biotin-LC-beta-Amyloid (1-40), Human
Biotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 24648 $363
Biotin-LC-beta-Amyloid (1-40), Human
Biotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 24645 $583
Biotin-LC-beta-Amyloid (17-40), Human, mouse/rat
Biotin-LC-LVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 24642 $396
Cys-beta-Amyloid (1-40), Human
CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 23519 $210
Cys-beta-Amyloid (1-40), Human
CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 23520 $300
Scrambled-beta-Amyloid (1-40), Human
AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
0.5 mg 24625 $181
Scrambled-beta-Amyloid (1-40), Human
AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
1 mg 24626 $335
  < Back