Diabetes and Insulin Related
  Beta-Amyloid Peptide Fragments

 Product Size Catalog # US$
Beta-Amyloid (1-11), Human
DAEFRHDSGYE
1 mg 22819 $71
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
1 mg 24225 $83
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
5 mg 24226 $341
Beta-Amyloid (1-33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
0.5 mg 60250-05 $253
Beta-Amyloid (1-33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
1 mg 60250-1 $413
Beta-Amyloid (1-36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
0.5 mg 60252-05 $264
Beta-Amyloid (1-36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
1 mg 60252-1 $423
Beta-Amyloid (1-37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
0.5 mg 60251-05 $264
Beta-Amyloid (1-37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
1 mg 60251-1 $423
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg 24233 $154
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg 24234 $275
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg 24295 $181
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
1 mg 24296 $335
Beta-Amyloid (10-20), Human
YEVHHQKLVFF
0.5 mg 25364 $39
Beta-Amyloid (10-20), Human
YEVHHQKLVFF
1 mg 25365 $61
Beta-Amyloid (11-22), Human
EVHHQKLVFFAE
1 mg 23956 $99
Beta-Amyloid (16-20), Human, mouse/rat
KLVFF
1 mg 60229-1 $61
Beta-Amyloid (16-20), Human, mouse/rat
KLVFF
5 mg 60229-5 $242
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
0.5 mg 22817 $193
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
1 mg 22818 $325
DABCYL-beta-Amyloid (11-22)-EDANS, Human
DABCYL-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-EDANS
1 mg 23551 $264
  < Back