Diabetes and Insulin Related
  Beta-Amyloid Peptides - Mouse/Rat

 Product Size Catalog # US$
Beta-Amyloid (1-16), mouse, rat
DAEFGHDSGFEVRHQK-NH2
1 mg AS-60889-1 $83
Beta-Amyloid (1-16), mouse, rat
DAEFGHDSGFEVRHQK-NH2
5 mg AS-60889-5 $341
Beta-Amyloid Peptide (1-40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg AS-25380 $264
Beta-Amyloid Peptide (1-40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg AS-25230 $423
Beta-Amyloid Peptide (1-42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
0.5 mg AS-25381 $341
Beta-Amyloid Peptide (1-42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
1 mg AS-25231 $545
  < Back