Diabetes and Insulin Related
  Beta-Amyloid Peptides - Mouse/Rat

 Product Size Catalog # US$
Beta-Amyloid (1-14), mouse, rat
DAEFGHDSGFEVRH
1 mg 60890-1 $83
Beta-Amyloid (1-14), mouse, rat
DAEFGHDSGFEVRH
5 mg 60890-5 $341
Beta-Amyloid (1-16), mouse, rat
DAEFGHDSGFEVRHQK-NH2
1 mg 60889-1 $83
Beta-Amyloid (1-16), mouse, rat
DAEFGHDSGFEVRHQK-NH2
5 mg 60889-5 $341
Beta-Amyloid Peptide (1-40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg 25380 $264
Beta-Amyloid Peptide (1-40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg 25230 $423
Beta-Amyloid Peptide (1-42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
0.5 mg 25381 $341
Beta-Amyloid Peptide (1-42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
1 mg 25231 $545
  < Back