Energy Homeostasis Regulation
  Pancreatic Polypeptides

 Product Size Catalog # US$
Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
0.5 mg AS-22866 $121
Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
1 mg AS-22867 $215
  < Back