Energy Homeostasis Regulation
  Pancreatic Polypeptides

 Product Size Catalog # US$
Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
0.5 mg 22866 $121
Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
1 mg 22867 $215
  < Back