Gastrointestinal and Related Peptides
  Gastrins

 Product Size Catalog # US$
Big Gastrin-1, human
Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
0.5 mg AS-20747 $259
Biotin-Gastrin (1-17)
Biotin-EGPWLEEEEEAYGWMDF-NH2
1 mg AS-60329-1 $143
Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
0.5 mg AS-24213 $115
Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
1 mg AS-24214 $193
Gastrin-1, human
Pyr-GPWLEEEEEAYGWMDF-NH2
1 mg AS-20750 $127
Gastrin-1, rat
Pyr-RPPMEEEEEAYGWMDF-NH2
1 mg AS-20752 $127
  < Back