Gastrointestinal and Related Peptides
  Glucagon-Like Peptides

 Product Size Catalog # US$
GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human
HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
1 mg AS-62068 $297
  < Back