Hormones
  Glucagon-Like Peptides

 Product Size Catalog # US$
Biotin-Glucagon (1-29), bovine, human, porcine
Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg 60274-05 $143
Biotin-Glucagon (1-29), bovine, human, porcine
Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg 60274-1 $242
Glucagon (1-29), bovine, human, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg 22456 $71
Glucagon (1-29), bovine, human, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg 22457 $127
Glucagon (1-29), bovine, human, porcine, FAM-labeled
FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
0.5 mg 60273-05 $143
Glucagon (1-29), bovine, human, porcine, FAM-labeled
FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
1 mg 60273-1 $242
Glucagon (1-37), Oxyntomodulin, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
1 mg 22455 $665
Glucagon-like Peptide-2, GLP-2 (146-178), human
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
1 mg 62070 $281
  < Back