Immunology
  Antimicrobial and Related Peptides

 Product Size Catalog # US$
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
0.5 mg AS-24009 $176
Cecropin A
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
1 mg AS-24010 $291
Cecropin B
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
0.5 mg AS-24011 $176
Cecropin B
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
1 mg AS-24012 $291
Histatin-5
DSHAKRHHGYKRKFHEKHHSHRGY
1 mg AS-61001 $193
Histatin-8 [Hemagglutination-Inhibiting Peptide (HIP)]
KFHEKHHSHRGY
1 mg AS-61002 $99
Indolicidin
ILPWKWPWWPWRR-NH2
1 mg AS-60999 $143
Innate Defense Regulator-1 (IDR-1)
KSRIVPAIPVSLL
1 mg AS-62514 $83
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
0.5 mg AS-20791 $99
Magainin 1
GIGKFLHSAGKFGKAFVGEIMKS
1 mg AS-20792 $143
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
0.5 mg AS-20639 $99
Magainin 2
GIGKFLHSAKKFGKAFVGEIMNS
1 mg AS-20640 $143
  < Back