
 Product Size Catalog # US$
CHRG01; Human β-Defensin 3 (hBD3) Derivative
1 mg 64886 $77
hBD-1, β-Defensin-1, human
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
0.1 mg 60740 $303
hBD-3, β-Defensin-3, human
0.1 mg 60741 $303
hBD-4, β-Defensin-4, human
ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK (Disulfide bridge: 6-33; 13-27; 17-34)
0.1 mg 60742 $303
HNP-1, Defensin Human Neutrophil Peptide-1
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
0.1 mg 60743 $198
HNP-2, Defensin Human Neutrophil Peptide-2
CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1-29, 3-18, 8-28)
0.1 mg 60744 $215
  < Back