Neurodegenerative Disorders Related
  Beta-Amyloid Peptide Fragments

 Product Size Catalog # US$
Beta-Amyloid (1-10)-GG-K(Biotin), Human
DAEFRHDSGYGG-K(Biotin)
1 mg 62134 $121
Beta-Amyloid (1-11), Human
DAEFRHDSGYE
1 mg 22819 $71
Beta-Amyloid (1-12)-Cys, Human
DAEFRHDSGYEVC
1 mg 65155 $71
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
1 mg 24225 $83
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
5 mg 24226 $341
Beta-Amyloid (1-16)-Lys(Biotin-LC)-NH2, Human
DAEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
1 mg 62136 $181
Beta-Amyloid (1-17), HiLyte™ Fluor 488-labeled, Human
HiLyte™ Fluor 488-DAEFRHDSGYEVHHQKL
0.1 mg 62953 $115
Beta-Amyloid (1-33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
0.5 mg 60250-05 $253
Beta-Amyloid (1-33), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
1 mg 60250-1 $413
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg 24233 $154
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg 24234 $275
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg 24295 $181
Beta-Amyloid (10-26), Human
YEVHHQKLVFFAEDVGS
1 mg 62885 $105
Beta-Amyloid (11-25), Human
EVHHQKLVFFAEDVG
1 mg 62884 $93
Beta-Amyloid (16-20), HiLyte™ Fluor 555-labeled, Human, mouse/rat
HiLyte™ Fluor 555-KLVFF
1 mg 63305 $291
Beta-Amyloid (2-16), Human
AEFRHDSGYEVHHQK
1 mg 64794 $83
Beta-Amyloid (2-16)-Lys(Biotin-LC)-NH2, Human
AEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
0.5 mg 64154 $99
Beta-Amyloid (25-35), HiLyte™ Fluor 488-labeled, Human, mouse/rat
HiLyte™ Fluor 488-GSNKGAIIGLM
0.1 mg 63308 $110
Beta-Amyloid (3-16)-Lys(Biotin-LC)-NH2, Human
EFRHDSGYEVHHQK-K(Biotin-LC)-NH2
0.5 mg 64155 $93
Beta-Amyloid (4-13), Human
FRHDSGYEVH
1 mg 62954 $77
Beta-Amyloid (4-16)-Lys(Biotin-LC)-NH2, Human
FRHDSGYEVHHQK-K(Biotin-LC)-NH2
0.5 mg 64156 $83
ClearPoint™ beta-Amyloid (1-38), 13C-Phe & Ile, Human
DAEFRHDSGYEVHHQKLV-*F-*F-AEDVGSNKGA-*I-*I-GLMVGG *F=Phe(U-13C9), *I=Ile(U-13C6)
0.05 mg 65220 $117
Cys-beta-Amyloid (1-12), Human
CDAEFRHDSGYEV
1 mg 64353 $105
  < Back