Neurotransmission
  Pancreatic Polypeptides

 Product Size Catalog # US$
Chromostatin, bovine
SDEDSDGDRPQASPGLGPGP
1 mg AS-60754 $110
Insulin B (13-23)
EALYLVCGERG
1 mg AS-62645 $77
Insulin B (9-23)
SHLVEALYLVCGERG
1 mg AS-61532 $115
Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
0.5 mg AS-22866 $121
Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
1 mg AS-22867 $215
  < Back