Neurotransmission
  Pancreatic Polypeptides

 Product Size Catalog # US$
Chromostatin, bovine
SDEDSDGDRPQASPGLGPGP
1 mg 60754 $110
Insulin B (13-23)
EALYLVCGERG
1 mg 62645 $77
Insulin B (9-23)
SHLVEALYLVCGERG
1 mg 61532 $115
Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
0.5 mg 22866 $121
Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
1 mg 22867 $215
  < Back