Neurotransmission
  Peptide YY and Analogs

 Product Size Catalog # US$
Peptide YY (3-36), human
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
0.5 mg AS-24405 $143
Peptide YY (3-36), human
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
1 mg AS-24406 $253
Peptide YY, human
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
0.5 mg AS-24401 $143
Peptide YY, human
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
1 mg AS-24402 $253
  < Back