Renin-Angiotensin-Aldosterone System Antagonists
   Disulfide Cyclized Peptides

 Product Size Catalog # US$
BNP (64-95), rat
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10-26)
1 mg 22931 $385
BNP-32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
0.5 mg 24015 $242
BNP-32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
1 mg 24016 $385
C-Type Natriuretic Peptide (32-53), human, porcine
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6-22)
1 mg 24244 $220
  < Back