Calcium Related
  Osteocalcin Fragments

 Product Size Catalog # US$
[Gla17,21,24]-Osteocalcin (1-49)
YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
0.1 mg 22829 $115
[Gla17,21,24]-Osteocalcin (1-49)
YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
0.5 mg 22830 $335
[Gla17,21,24]-Osteocalcin (1-49)
YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
1 mg 22831 $721
Des-gamma-carboxylated Osteocalcin/Bone Gla Protein
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
0.25 mg 65307-025 $175
  < Back