Calcium Related
  Ion Channel Peptides

 Product Size Catalog # US$
Kv3, Channel Containing Protein (567-585)
CKESPVIAKYMPTEAVRVT
1 mg 62696 $115
Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP)
KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
1 mg 64606 $220
  < Back