HIV
  HIV Related Peptides

 Product Size Catalog # US$
Biotin-TAT (47-57)
Biotin-YGRKKRRQRRR
1 mg 61209 $115
C34-LC-Biotin, gp41 HIV fragment
WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC-Biotin)
0.5 mg 62103 $215
Cys(Npys)-TAT (47-57)
C(Npys)YGRKKRRQRRR-NH2
1 mg 61214 $242
Cys(Npys)-TAT (47-57), FAM-labeled
C(Npys)YGRKKRRQRRR-K(FAM)-NH2
1 mg 61213 $291
Cys-TAT (47-57)
CYGRKKRRQRRR-NH2
1 mg 61212 $99
FITC-beta-Ala-NYAD-1 (NYAD-2)
FITC-(beta-A)-ITFXDLLXYYGP-NH2 (with special cyclization to get double bond, X= (S)-alpha-(2-pentenyl)alanine)
0.25 mg 63733-025 $423
FITC-LC-TAT (47-57)
FITC-LC-YGRKKRRQRRR-NH2
0.5 mg 27042 $154
FITC-LC-TAT (47-57)
FITC-LC-YGRKKRRQRRR-NH2
1 mg 27043 $242
Gag Spacer Peptide P1
HHHHHHIIKIIK
1 mg 64773 $66
HIV Protease FRET Substrate I 1 mg 22992 $231
HIV Substrate
KARVNleF(4-NO2)EANle-NH2
1 mg 24286 $66
HIV-1 Protease Substrate, chromogenic
Ac-RKILF(4-NO2)LDG-NH2
5 mg 22089 $242
Hydrocarbon-Stapled Helix SAHBA Peptide
EDIIRNIARHLAXVGDX-Nle-DRSIW (with special cyclization to get double bond, X= (S)-2-(2-pentenyl)alanine)
5 mg 63735-5 $1540
NYAD-1
ITFXDLLXYYGP-NH2 (with special cyclization to get double bond, X= (S)-alpha-(2-pentenyl)alanine)
1 mg 63734-1 $423
T20
Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
1 mg 61235 $363
TAT (47-57)
YGRKKRRQRRR
1 mg 60023-1 $93
TAT (47-57)
YGRKKRRQRRR
5 mg 60023-5 $363
TAT (47-57) GGG-Cys(Npys)
YGRKKRRQRRRGGG-C(Npys)-NH2
1 mg 61215 $242
TAT (47-57), FAM-labeled
FAM-YGRKKRRQRRR
1 mg 61210 $203
TAT (47-57), TAMRA-labeled
TAMRA-YGRKKRRQRRR
1 mg 61211 $231
  < Back