HCV
  Hepatitis C Virus (HCV) Related Peptides

 Product Size Catalog # US$
4A/4B, 5A/5B Peptide
Ac-DEMEECSMSY-NH2
5 mg 24487 $1017
HCV (Hepatitis C Virus) NS3/4A Protease Substrate
Ac-DE-Dap(QXL520)-EE-Abu-ψ-[COO]AS-C(5-FAMsp)-NH2
1 mg 60798 $726
HCV NS3/4A Protease Substrate Hydrolysis Product 1
Ac-DE-Dap(QXL520)-EE-Abu
1 mg 60978 $545
HCV NS3/4A Protease Substrate Hydrolysis Product 2
Lac-SC(5-FAMsp)-NH2
1 mg 60979 $423
Hepatitis Virus C NS3 Protease Inhibitor 2
Ac-DE-Dif-E-Cha-C
1 mg 25346 $423
Hepatitis Virus C NS3 Protease Inhibitor 2
Ac-DE-Dif-E-Cha-C
5 mg 24489 $1271
Hepatitis Virus C NS3 Protease Inhibitor 4
Ac-DELE-Cha-C
1 mg 25348 $181
KK4A
KKGSVVIVGRIVLSGK
5 mg 24491 $1017
NS4A-NS4B Hepatitis Virus C, NS3 Protease Inhibitor 1
Ac-DEMEEC
1 mg 25345 $220
PEP1
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
1 mg 60430-1 $291
RET S1 Hydrolysis Product 1
Ac-DED(EDANS)-EEAbu
1 mg 25334 $423
RET S1 Hydrolysis Product 2
Lac-SK(DABCYL)-NH2
1 mg 25132-1 $423
RET S1 Hydrolysis Product 2
Lac-SK(DABCYL)-NH2
5 mg 25132-5 $1694
  < Back