Apoptosis
  Protein Phosphorylation Related Peptides

 Product Size Catalog # US$
PDKtide, biotin labeled
Biotin-Ahx[protein fragment, 39 aa]
1 mg AS-64224 $385
R18 Peptide
PHCVPRDLSWLDLEANMCLP
1 mg AS-62160 $154
  < Back