Apoptosis
  Cancer Research Peptides

 Product Size Catalog # US$
Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
1 mg 62262 $281
BAD Peptide, biotin-labeled
Biotin-LC-AGAGRSRHSSYPAGT
1 mg 62269 $121
Bak BH3 (69-93)
STMGQVGRQLAIIGDDINRRYDSEF
1 mg 62272 $198
Bax BH3 peptide (55-74), wild type
STKKLSECLKRIGDELDSNM
1 mg 62266 $121
Bax H2-H3 (53-86), Helix 2-3
DASTKKLSECLKRIGDELDSNMELQRMIAAVDTD
1 mg 62283 $291
BH3 BIM Peptide (52-71), human
Ac-MRPEIWIAQELRRIGDEFNA
1 mg 62439 $121
Bid BH3, Peptide II, TAMRA labeled
5-TAMRA-EDIIRNIARHLAQVGDSMDR
1 mg 62277 $181
Bid BH3-R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
1 mg 62057 $231
Bim BH3, Peptide III
DMRPEIWIAQELRRIGDEFNAYYAR
1 mg 62278 $198
Bim BH3, Peptide IV
DMRPEIWIAQELRRIGDEFNAYYARR
1 mg 62279 $203
Noxa BH3, Peptide 1
PAELEVECATQLRRFGDKLNFRQKLL
1 mg 62282 $198
PDKtide, biotin labeled
Biotin-Ahx-KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
1 mg 64224 $385
  < Back