Apoptosis
  Apoptosis Peptides

 Product Size Catalog # US$
Antennapedia Bak BH3 (Ant-BH3) (71-89) Fusion peptide
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY
1 mg 62262 $281
Bak BH3 (69-93)
STMGQVGRQLAIIGDDINRRYDSEF
1 mg 62272 $198
Bax BH3 peptide (55-74), wild type
STKKLSECLKRIGDELDSNM
1 mg 62266 $121
Bid BH3, Peptide II, TAMRA labeled
5-TAMRA-EDIIRNIARHLAQVGDSMDR
1 mg 62277 $181
Bid BH3-R8
RRRRRRRRGEDIIRNIARHLAQVGDSMDR
1 mg 62057 $231
Caspase 1 (ICE) Inhibitor I
Ac-YVAD-CHO
5 mg 25277-5 $242
Caspase 1 (ICE) Substrate 1m, fluorogenic
Ac-YEVD-AMC
5 mg 25267-5 $154
Caspase 1 (ICE) Substrate 2, chromogenic
Ac-YVAD-pNA
5 mg 25259-5 $105
Caspase 1 (ICE) Substrate 2m, fluorogenic
Ac-YVAD-AMC
5 mg 25261-5 $154
Caspase 1 (ICE) Substrate 2r, fluorogenic
(Ac-YVAD)2-Rh110
1 mg 60310-1 $154
Caspase 1 (ICE) Substrate 3f, fluorogenic
Ac-WEHD-AFC
5 mg 25285-5 $181
Caspase 1 Substrate III
Ac-WEHD-pNA
1 mg 60843 $33
Caspase 2 (ICH-1) Substrate 1m, fluorogenic
Ac-VDVAD-AMC
5 mg 25255-5 $154
Caspase 3 (Apopain) Inhibitor 1
Ac-DEVD-CHO
5 mg 25269-5 $231
Caspase 3 (Apopain) Inhibitor 1b
Biotin-DEVD-CHO
5 mg 25281-5 $242
Caspase 3 (Apopain) Substrate 1, chromogenic
Ac-DEVD-pNA
5 mg 25263-5 $83
Caspase 3 (Apopain) Substrate 1f, fluorogenic
Ac-DEVD-AFC
5 mg 25273-5 $181
Caspase 3 (Apopain) Substrate 1m, fluorogenic
Ac-DEVD-AMC
5 mg 25262-5 $154
Caspase 3 (Apopain) Substrate 1r-z, fluorogenic
(Z-DEVD)2-Rh110
5 mg 60304-5 $350
Caspase 6 (Mch2) Substrate 1f, fluorogenic
Ac-VEID-AFC
5 mg 25272-5 $181
Caspase 6 (Mch2) Substrate 1m, fluorogenic
Ac-VEID-AMC
5 mg 25256-5 $154
Caspase 6 (Mch2) Substrate 1r, fluorogenic
(Ac-VEID)2-Rh110
1 mg 60308-1 $154
Caspase 6 (Mch2) Substrate 2, fluorogenic
Mca-VQVDGW-K(Dnp)-NH2
5 mg 25284-5 $242
Caspase 6 (Mch2) Substrate 2, fluorogenic
Mca-VQVDGW-K(Dnp)-NH2
25 mg 25284-25 $847
Caspase 8 Substrate 1, chromogenic
Ac-IETD-pNA
5 mg 25258-5 $105
Caspase 8 Substrate 1f, fluorogenic
Ac-IETD-AFC
5 mg 25270-5 $181
Caspase 8 Substrate 1m, fluorogenic
Ac-IETD-AMC
5 mg 25257-5 $154
Caspase 8 Substrate 1r-z, fluorogenic
(Z-IEHD)2-Rh110
5 mg 60312-5 $237
Caspase 9 Substrate 1, chromogenic
Ac-LEHD-pNA
5 mg 25278-5 $105
Caspase 9 Substrate 1f, fluorogenic
Ac-LEHD-AFC
5 mg 25276-5 $181
Caspase 9 Substrate 2m, fluorogenic
Ac-LEHD-AMC
5 mg 25286-5 $181
Pro-apoptotic Peptide, klaklakklaklak, 5-FAM-labeled
5-FAM-klaklakklaklak-NH2
1 mg 62206 $242
PUMA BH3
EEQWAREIGAQLRRMADDLNAQYER
1 mg 62404 $198
SensoLyte® AFC Caspase Profiling Kit *Fluorimetric* 1 kit 71116 $627
SensoLyte® AFC Caspase Substrate Sampler Kit *Fluorimetric* 1 kit 71117 $501
SensoLyte® AMC Caspase Profiling Kit *Fluorimetric* 1 kit 71120 $627
SensoLyte® AMC Caspase Substrate Sampler Kit *Fluorimetric* 1 kit 71121 $501
SensoLyte® Homogeneous AFC Caspase - 8 Assay Kit
200 assays (96 - well plate)
1 kit 72088-200 $374
SensoLyte® Homogeneous AFC Caspase - 8 Assay Kit
100 assays (96 - well plate)
1 kit 72088-100 $247
SensoLyte® Homogeneous AMC Caspase-3/7 Assay Kit
500 assays (96-well plate)
1 kit 71118 $272
SensoLyte® Homogeneous AnaRed Caspase-3/7 Assay Kit
500 assays (96-well plate)
1 kit 71122 $374
SensoLyte® Homogeneous AFC Caspase-3/7 Assay Kit
500 assays (96-well plate)
1 kit 71114 $272
Smac/Diablo Peptide [AVPIAQKSE], 5-FAM labeled
AVPIAQKSEK-K(5-FAM)-NH2
1 mg 64758 $220
Z-DEVD-AFC 5 mg 21685-5 $181
Z-DEVD-AMC
Z-DEVD-AMC
5 mg 60303-5 $181
  < Back