Protein Tag
  Tag Peptides

 Product Size Catalog # US$
3 x Hemagglutinin (HA) Tag
MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
1 mg AS-63764 $347
Glu-Glu epitope Tag
EYMPME
5 mg AS-62189 $143
HA 12CA5 Epitope
CYPYDVPDYA
1 mg AS-62229 $115
Rhodopsin Epitope Tag
TETSQVAPA
5 mg AS-62190 $193
  < Back