Exocytosis
  Cell Permeable Peptides (CPP) / Drug Delivery Peptides

 Product Size Catalog # US$
TAT-NSF222scr Fusion Polypeptide, scrambled
YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE
1 mg 62210 $308
TAT-NSF700 Fusion Peptide
YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL
1 mg 62238 $325
TAT-NSF700scr
YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
1 mg 62209 $308
TAT-NSF81scr Fusion Polypeptide , scrambled
YGRKKRRQRRR-GGG-QDGCKYFATDETIMKLSIAI
1 mg 62215 $269
  < Back