Neuroendocrine
  Islet Amyloid Polypeptides (IAPP)

 Product Size Catalog # US$
[NMeG24, NMeI26] Human Islet Amyloid Polypeptide (IAPP) (22-27)
NF-(NMe-G)-A-(NMe-I)-L
1 mg AS-61937 $220
Amylin (1-37), rat
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
0.5 mg AS-60253-05 $303
Amylin (1-37), rat
KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
1 mg AS-60253-1 $479
  < Back