Osteoporosis
  Calcitonin Related Peptides

 Product Size Catalog # US$
α-Calcitonin Gene Related Peptide, α-CGRP, rat
SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
1 mg AS-60730 $259
β-CGRP, human
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
1 mg AS-64563-1 $330
β-CGRP, human
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
0.5 mg AS-64563-05 $198
Biotin-Calcitonin, human
Biotin-CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
0.5 mg AS-23580 $303
Calcitonin Gene Related Peptide, CGRP (8-37), human
VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
1 mg AS-22857 $215
Calcitonin Gene Related Peptide, CGRP (8-37), rat
VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2
1 mg AS-62956 $237
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
0.5 mg AS-20681 $154
Calcitonin Gene Related Peptide, CGRP, human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
1 mg AS-20682 $259
Calcitonin N-Terminal Flanking Peptide, human, N-Procalcitonin
APFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRS
1 mg AS-20680 $577
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
1 mg AS-20673 $137
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
5 mg AS-20674 $577
Calcitonin, rat
CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (Disulfide bridge: 1-7)
5 mg AS-24205 $577
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
1 mg AS-20677 $121
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
5 mg AS-20678 $484
  < Back