Products

Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.

    1 - 13 of 13

    HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg

    • QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
    • Cat.Number : AS-60635
    Quick view

    IV9 (476-484), HIV-1 RT Epitope - 1 mg

    • ILKEPVHGV
    • Cat.Number : AS-61524
    Quick view

    T20, Enfuvirtide - 1 mg

    • Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
    • Cat.Number : AS-61235
    Quick view

    C34, gp41 HIV Fragment - 1 mg

    • WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
    • Cat.Number : AS-62101
    Quick view

    West Nile Virus NS3 Protease, recombinant

    • Cat.Number : AS-72081-5
    Quick view

    HIV Protease FRET Substrate I - 1 mg

    • DABCYL-GABA-SQNYPIVQ-EDANS
    • Cat.Number : AS-22992
    Quick view

    SensoLyte® 570 West Nile Virus Protease Assay Kit Fluorimetric - 1 kit

    • Cat.Number : AS-72080
    Quick view

    SensoLyte® 490 HIV Protease Assay Kit Fluorimetric - 1 kit

    • Cat.Number : AS-71127
    Quick view

    SensoLyte® 520 HIV Protease Assay Kit Fluorimetric - 1 kit

    • Cat.Number : AS-71147
    Quick view

    SensoLyte® 440 West Nile Virus Protease Assay Kit Fluorimetric - 1 kit

    • Cat.Number : AS-72079
    Quick view

    HIV-1 protease, recombinant - 5 µg

    • Cat.Number : AS-72028-5
    Quick view

    Prostatic Acid Phosphatase (248-286), PAP (248-286) - 1 mg

    • GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
    • Cat.Number : AS-64518
    Quick view

    Gag Spacer Peptide P1 - 1 mg

    • HHHHHHIIKIIK
    • Cat.Number : AS-64773
    Quick view
      1 - 13 of 13