New Products from AnaSpec
 Total # of New Products: 10    

  Adrenomedullin Peptides
 Product Size Catalog # US$  
Proadrenomedullin N - terminal 20 peptide, PAMP (1 - 20)  NEW
ARLDVASEFRKKWNKWALSR - NH3
ARLDVASEFRKKWNKWALSR - NH3
5 mg 65455-5 $200
Proadrenomedullin N - terminal 20 peptide, PAMP (1 - 20)  NEW
ARLDVASEFRKKWNKWALSR - NH2
ARLDVASEFRKKWNKWALSR - NH2
1 mg 65455-1 $90
  Antimicrobial and Related Peptides
 Product Size Catalog # US$  
LL13 - 37  NEW
IGKEFKRIVQRIKDFLRNLVPRTES
IGKEFKRIVQRIKDFLRNLVPRTES
5 mg 65453-5 $200
LL13 - 37  NEW
IGKEFKRIVQRIKDFLRNLVPRTES
IGKEFKRIVQRIKDFLRNLVPRTES
1 mg 65453-1 $90
LL17 - 29  NEW
FKRIVQRIKDFLR
FKRIVQRIKDFLR
1 mg 65454-1 $70
  Cancer Research Peptides
 Product Size Catalog # US$  
Apolipoprotein KV domain (67 - 77), KV11  NEW
YTMNPRKLFDY 
YTMNPRKLFDY 
1 mg 65477 $109
CXCL4/PF - 4 (47 - 70)  NEW
NGRKICLDLQAPLYKKIIKKLLES
NGRKICLDLQAPLYKKIIKKLLES
1 mg 65474 $228
CXCL4L1/PF - 4var (47 - 70)  NEW
NGRKICLDLQALLYKKIIKEHLES
NGRKICLDLQALLYKKIIKEHLES
1 mg 65475 $228
  Cell Permeable Peptides (CPP) / Drug Delivery Peptides
 Product Size Catalog # US$  
Beclin - 1  NEW
TNVFNATFHIWHSGQFGT
TNVFNATFHIWHSGQFGT
1 mg 65466 $110
hCT (Calcitonin), Human  NEW
LGTYTQDFNKFHTFPQTAIGVGAP
LGTYTQDFNKFHTFPQTAIGVGAP
1 mg 65458 $110
KALA  NEW
WEAKLAKALAKALAKHLAKALAKALKACEA
WEAKLAKALAKALAKHLAKALAKALKACEA
1 mg 65459 $195
  Guanylins
 Product Size Catalog # US$  
Uroguanylin (Rat)  NEW
TDECELCINVACTGC (Disulfide bonds between Cys4 - Cys12 and Cys7 - Cys15)
TDECELCINVACTGC (Disulfide bonds between Cys4 - Cys12 and Cys7 - Cys15)
1 mg 61645 $242
  Luteinizing Hormone-Releasing Hormones and Related Peptides
 Product Size Catalog # US$  
Luteinizing Hormone - Releasing Hormone (LH - RH), human, free acid  NEW
Pyr - HWSYGLRPG
Pyr - HWSYGLRPG
5 mg 65456-5 $150
Luteinizing Hormone - Releasing Hormone (LH - RH), human, free acid  NEW
Pyr - HWSYGLRPG
Pyr - HWSYGLRPG
1 mg 65456-1 $70
  Neuropeptides
 Product Size Catalog # US$  
P0 (106 - 125)  NEW
Peripheral Myelin Protein P0 (106 - 125), mouse
IVGKTSQVTLYVFEKVPTRY
1 mg 65469 $161
P0 (180 - 199)  NEW
Peripheral Myelin P0 Protein (180 - 199), mouse
SSKRGRQTPVLYAMLDHSRS
1 mg 65470 $161
P0 (56 - 71)  NEW
Peripheral Myelin Protein P0 (56 - 71), rat
GQPYIDEVGTEKERIQ
1 mg 65471 $113
  Tau Peptides
 Product Size Catalog # US$  
[Ser(OGlcNAc)]400 - KWK - Tau (388 - 411) - KK(Biotin) - NH2  NEW
KWKHGAEIVYKSPVV - S(OGlcNAc) - GDTSPRHLSNVK - K(biotin) - NH2
KWKHGAEIVYKSPVV - S(OGlcNAc) - GDTSPRHLSNVK - K(bio
tin) - NH2
1 mg 65409-1 $385
[Ser(OGlcNAc)]400 - KWK - Tau (388 - 411) - KK(Biotin) - NH2  NEW
KWKHGAEIVYKSPVV - S(OGlcNAc) - GDTSPRHLSNVK - K(biotin) - NH2
KWKHGAEIVYKSPVV - S(OGlcNAc) - GDTSPRHLSNVK - K(bio
tin) - NH2
0.25 mg 65409-025 $143
Tau Peptide (244 - 274) (Repeat 1 domain)  NEW
Ac - QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
Ac - QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
5 mg 65433-5 $270
  Tubulin Peptides
 Product Size Catalog # US$  
[Lys(Ac)40] - Ac - a - Tubulin (29 - 50) - WGK(Biotin); TubK40(Ac) - WGK, biotin - labeled  NEW
Ac - GIQPDGQMPSD - K(ac) - TIGGGDDSFNWG - K(biotin)
Ac - GIQPDGQMPSD - K(ac) - TIGGGDDSFNWG - K(biotin)
1 mg 65411-1 $340
[Lys(Ac)40] - Ac - a - Tubulin (29 - 50) - WGK(Biotin); TubK40(Ac) - WGK, biotin - labeled  NEW
Ac - GIQPDGQMPSD - K(ac) - TIGGGDDSFNWG - K(biotin)
Ac - GIQPDGQMPSD - K(ac) - TIGGGDDSFNWG - K(biotin)
0.25 mg 65411-025 $121
 Total # of New Products: 10