New Products from AnaSpec
 Total # of New Products: 12     Showing 1 to 10 Page  of 2

  Adrenomedullin Peptides
 Product Size Catalog # US$  
Proadrenomedullin N - terminal 20 peptide, PAMP (1 - 20)  NEW
ARLDVASEFRKKWNKWALSR - NH3
5 mg AS-65455-5 $200
  Antimicrobial and Related Peptides
 Product Size Catalog # US$  
LL17 - 29  NEW
FKRIVQRIKDFLR
5 mg AS-65454-5 $150
LL17 - 32  NEW
FKRIVQRIKDFLRNLV
5 mg AS-65452-5 $150
LL17 - 32  NEW
FKRIVQRIKDFLRNLV
1 mg AS-65452-1 $70
  Cell Permeable Peptides (CPP) / Drug Delivery Peptides
 Product Size Catalog # US$  
KALA  NEW
WEAKLAKALAKALAKHLAKALAKALKACEA
1 mg AS-65459 $195
Penetratin - Arg  NEW
RQIRIWFQNRRMRWRR
1 mg AS-65464 $110
pVEC (Cadherin - 5)  NEW
LLIILRRRIRKQAHAHSK
1 mg AS-65465 $110
  Gastric Inhibitory Peptides (GIPs)
 Product Size Catalog # US$  
GIP, rat  NEW
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
0.5 mg AS-65568-05 $198
GIP, rat  NEW
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
1 mg AS-65568-1 $363
  Guanylins
 Product Size Catalog # US$  
Uroguanylin (Rat)  NEW
TDECELCINVACTGC (Disulfide bonds between Cys4 - Cys12 and Cys7 - Cys15)
1 mg AS-61645 $242
  Myelin Oligodendrocyte Glycoprotein (MOG)/Myelin Basic Proteins (MBP)
 Product Size Catalog # US$  
MOG (35 - 55), mouse, rat  NEW
MEVGWYRSPFSRVVHLYRNGK
10 mg AS-60130-10 $800
  Nesfatins
 Product Size Catalog # US$  
Nesfatin - 1 (24 - 53), human  NEW 0.5 mg AS-65571 $188
Nesfatin - 1 (24 - 53), mouse  NEW 0.5 mg AS-65572 $188
  Neurogranin
 Product Size Catalog # US$  
biotin - Neurogranin (48 - 76), human  NEW 1 mg AS-65576 $348
biotin - Neurogranin (48 - 76), mouse  NEW 1 mg AS-65577 $348
Neurogranin (48 - 76), human  NEW 1 mg AS-65575 $341
  Neuropeptides
 Product Size Catalog # US$  
P0 (180 - 199)  NEW
Peripheral Myelin P0 Protein (180 - 199), mouse
1 mg AS-65470 $161
P2 (53 - 78)  NEW
Peripheral Myelin Protein P2 (53 - 78), bovine
1 mg AS-65472 $242
  Orexins
 Product Size Catalog # US$  
Orexin B, human  NEW 1 mg AS-65573 $255
Orexin B, mouse  NEW 1 mg AS-65574 $255
 Total # of New Products: 12     Showing 1 to 10 Page  of 2