Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Pyr11]-beta-Amyloid (11-42), Human

Product Name [Pyr11] - beta - Amyloid (11 - 42), Human
Pyr - VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 1 mg
Catalog # 29903-1
US$ $484
Purity % Peak Area By HPLC ≥ 95%
Description

As are generated by the proteolytic processing of the amyloid -precursor protein (APP). Subsequent cleavage by g-secretase gives rise to A (1-40/42) and A (11-40/42). A (11-40) and A (11-42) are major A cleavage products generated by BACE.

Detailed Information Datasheet
Storage -20C
References Liu, K. et al. Biochem. 41, 3128 (2002).
Molecular Weight 3317.9
Sequence
(One-Letter Code)
Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
Pyr - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Piccini, A. et al. J. Biol. Chem. 280, 34186 (2005).
     
  < Back