Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Natriuretic Peptides  >>  BNP (64-95), rat

Product Name BNP (64 - 95), rat
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10 - 26)
Size 1 mg
Catalog # AS-22931
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

The BNP-32 is a 32 amino acid peptide of the B-type or brain natriuretic peptide (BNP). BNP was initially isolated from porcine brain but mainly found to be released from cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is known to suppress the renin-angiotensin-aldosterone system having vasodilatory effects. Processing of BNP prohormones to BNP-32 in higher mammals appears to require a protease with a conserved recognition sequence (RXXR-S).

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References 1, Vink, S. et al. Toxicon. 59(4), (2012).
2, Bidzseranova, A. et al. Physiol. Behavior. 52, 227 (1992).
Molecular Weight 3452
Sequence
(One-Letter Code)
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10-26)
Sequence
(Three-Letter Code)
H - Asn - Ser - Lys - Met - Ala - His - Ser - Ser - Ser - Cys - Phe - Gly - Gln - Lys - Ile - Asp - Arg - Ile - Gly - Ala - Val - Ser - Arg - Leu - Gly - Cys - Asp - Gly - Leu - Arg - Leu - Phe - OH (Disulfide bridge: 10 - 26)
     
  < Back