Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Agouti Related Peptides  >>  AGRP (87-132), human

Product Name AGRP (87 - 132), human
Ac - CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Size 0.1 mg
Catalog # 27122
US$ $457
Purity % Peak Area By HPLC ≥ 95%
Description

The cysteine-rich C-terminal domain of AGRP, corresponding to AGRP(87-132), exhibits receptor binding affinity and antagonism equivalent to that of the full-length protein.

Storage -20C
References Ref: Yang, Y. et al. Mol. Endocrinol. 13, 148 (1999); Wilczynski, A. et al. J. Med. Chem. 47, 5662 (2004); Wilczynski, A. et al. J. Med. Chem. 47, 2194 (2004); Millhauser, G. et al. Ann. N. Y. Acad. Sci. 994, 27 (2003).
Molecular Weight 5202.2
Sequence
(One-Letter Code)
Ac-CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Sequence
(Three-Letter Code)
Ac - Cys - Val - Arg - Leu - His - Glu - Ser - Cys - Leu - Gly - Gln - Gln - Val - Pro - Cys - Cys - Asp - Pro - Cys - Ala - Thr - Cys - Tyr - Cys - Arg - Phe - Phe - Asn - Ala - Phe - Cys - Tyr - Cys - Arg - Lys - Leu - Gly - Thr - Ala - Met - Asn - Pro - Cys - Ser - Arg - Thr - OH.
     
  < Back