Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Growth Factors  >>  Growth Hormone Releasing Factor, GRF (1-29), amide, human

Product Name Growth Hormone Releasing Factor, GRF (1 - 29), amide, human
YADAIFTNSYRKVLGQLSARKLLQDIMSR - NH2
Size 1 mg
Catalog # AS-22875
US$ $121
Purity % Peak Area By HPLC ≥ 95%
Description

This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Ling, N. et al. Proc Natl Acad Sci USA 81, 4302 (1984)
Gaudreau, P. et al. J Med Chem 35, 1864 (1992), doi: 10.1021/jm00088a023
Lance, VA. et al. Biochem Biophys Res Commun 119, 265 (1984), doi: 10.1016/0006-291X(84)91647-4
Lapierre, H. et al. Domest Anim Endocrinol 4, 207 (1987)
Mayo, KE. et al. Nature 306, 86 (1983)
Rivier, J. et al. Nature 300, 276 (1982), doi:10.1038/300276a0
Grossman, A. et al. Clin Endocrinol (Oxf) 21, 321 (1984)
Molecular Weight 3357.9
Sequence
(One-Letter Code)
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sequence
(Three-Letter Code)
H - Tyr - Ala - Asp - Ala - Ile - Phe - Thr - Asn - Ser - Tyr - Arg - Lys - Val - Leu - Gly - Gln - Leu - Ser - Ala - Arg - Lys - Leu - Leu - Gln - Asp - Ile - Met - Ser - Arg - NH2
     
  < Back