Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Defensins  >>  hBD-1, β-Defensin-1, human

Product Name hBD - 1, β - Defensin - 1, human
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)
Size 0.1 mg
Catalog # AS-60740
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Description

This is a 3.9kDa 36-amino acid peptide called beta-Defensin-1 (hBD-1) having a beta sheet with three intramolecular disulfide bonds. It is constitutively produced by various epithelial tissues including urogenital and respiratory tracts. It's expression is also inducible in keratinocytes of whole human skin by lipopolysaccharides and peptidoglycan. hBD-1 exhibits antimicrobial activity against several pathogenic microorganisms including E.coli, although its activity is dependent on salt sensitivity, because it is inhibited by salt in a concentration-dependent manner. In addition to its antimicrobial activity, hBD-1 chemoattracts CC chemokine receptor (CCR)6-expressing HEK293 cells, implying that this peptide utilizes CCR6 as a receptor.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Niyonsaba F and Ogawa H. J Derm Sci. 40, 157-168 (2005).
Molecular Weight 3929.6
Sequence
(One-Letter Code)
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
Sequence
(Three-Letter Code)
H - Asp - His - Tyr - Asn - Cys - Val - Ser - Ser - Gly - Gly - Gln - Cys - Leu - Tyr - Ser - Ala - Cys - Pro - Ile - Phe - Thr - Lys - Ile - Gln - Gly - Thr - Cys - Tyr - Arg - Gly - Lys - Ala - Lys - Cys - Cys - Lys - OH (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)
Product Citations Kooi, C. & Sokol, PA. (2009). Burkholderia cenocepacia zinc metalloproteases influence resistance to antimicrobial peptides Microbiol 155 2818-2825 doi:10.1099/mic.0.028969-0.

Gryllos, I. et al. (2008). Induction of group A Streptococcus virulence by a human antimicrobial peptide PNAS 105, 16755.
     
  < Back