Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  ACTH and Related Peptides  >>  Biotin-ACTH (1-39), human

Product Name Biotin - ACTH (1 - 39), human
Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Size 0.5 mg
Catalog # 23968
US$ $225
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4768.4
Sequence
(One-Letter Code)
Biotin-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence
(Three-Letter Code)
Biotin - Ser - Tyr - Ser - Met - Glu - His - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - Phe - OH
     
  < Back