Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Glucagon-Like Peptides  >>  Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human

Product Name Glucagon - Like Peptide 1, GLP - 1 (7 - 36) - Lys(Biotin), amide, human
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin) - NH2
Size 0.5 mg
Catalog # AS-23642
US$ $275
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987)
Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999)
Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160
Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7
Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229
Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197
Molecular Weight 3551.8
Sequence
(One-Letter Code)
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
Sequence
(Three-Letter Code)
H - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - Lys(Biotin) - NH2
     
  < Back