Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Human

Product Name Beta - Amyloid (1 - 40) - Lys(Biotin) - NH2, Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - K(Biotin) - NH2
Size 0.1 mg
Catalog # AS-61483-01
US$ $165
Purity % Peak Area By HPLC ≥ 95%
Description

Beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein. These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is biotinylated at the C-terminus.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 4683.4
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Lys(Biotin) - NH2
     
  < Back