Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Glucagon-Like Peptides  >>  Glucagon-like Peptide-2, GLP-2 (146-178), human

Product Name Glucagon - like Peptide - 2, GLP - 2 (146 - 178), human
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Size 1 mg
Catalog # AS-62070
US$ $281
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Cameron, H. et al. JPET 314, 214 (2005).
Molecular Weight 3766.2
Sequence
(One-Letter Code)
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Sequence
(Three-Letter Code)
H - His - Ala - Asp - Gly - Ser - Phe - Ser - Asp - Glu - Met - Asn - Thr - Ile - Leu - Asp - Asn - Leu - Ala - Ala - Arg - Asp - Phe - Ile - Asn - Trp - Leu - Ile - Gln - Thr - Lys - Ile - Thr - Asp - OH
     
  < Back