Glucagon - like Peptide - 2, GLP - 2 (146 - 178), human HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Size
1 mg
Catalog #
AS-62070
US$
$281
Purity
% Peak Area By HPLC ≥ 95%
Description
This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.
H - His - Ala - Asp - Gly - Ser - Phe - Ser - Asp - Glu - Met - Asn - Thr - Ile - Leu - Asp - Asn - Leu - Ala - Ala - Arg - Asp - Phe - Ile - Asn - Trp - Leu - Ile - Gln - Thr - Lys - Ile - Thr - Asp - OH