Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  ClearPoint™ beta-Amyloid (8-42), U-13C, 15N -labeled at Val12, Human

Product Name ClearPoint™ beta - Amyloid (8 - 42), U - 13C, 15N - labeled at Val12, Human
SGYE - V* - HHQKLVFFAEDVGSNKGAIIGLMVGGVVIA [V*=V(U - 13C5, U - 15N)]
Size 50 µg
Catalog # 63742
US$ $115
Purity % Peak Area By HPLC ≥ 95%
Description

ClearPoint™ beta-Amyloid (8-42) is a heavy-isotope labeled peptide. Val at position 12 has universally labeled 13C and 15N.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
Molecular Weight 3649.2
Sequence
(One-Letter Code)
SGYE-V*-HHQKLVFFAEDVGSNKGAIIGLMVGGVVIA [V*=V(U-13C5, U-15N)]
Sequence
(Three-Letter Code)
H - Ser - Gly - Tyr - Glu - Val* - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH [Val*=Val(U - 13C5, U - 15N)]
     
  < Back