Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptides - Mouse/Rat  >>  Beta-Amyloid (1-39), mouse, rat

Product Name Beta - Amyloid (1 - 39), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGV
Size 0.5 mg
Catalog # 63000
US$ $193
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1 to 39 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4134.7
Sequence
(One-Letter Code)
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Gly - His - Asp - Ser - Gly - Phe - Glu - Val - Arg - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - OH
     
  < Back