Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Cys(5-TAMRA maleimide)]-beta-Amyloid (1-40), Human

Product Name [Cys(5 - TAMRA maleimide)] - beta - Amyloid (1 - 40), Human
C(5 - TAMRA maleimide) - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # 64419
US$ $176
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4914.5
Sequence
(One-Letter Code)
C(5-TAMRA maleimide)-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
Cys(5 - TAMRA maleimide) - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back