Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Glucagon  >>  GLP-1(9-36), amide, human

Product Name GLP - 1(9 - 36), amide, human
EGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
Size 1 mg
Catalog # 65070
US$ $203
Description

This peptide is residues 9-36 of glucagon-like peptide 1 (GLP-1). GLP-1 is a neuroendocrine hormone derived from preproglucagon secreted by intestinal L cells. GLP-1 stimulates glucose-dependent insulin secretion and inhibits glucagon secretion.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References John, H. et a. Eur J Med Res 13, 73 (2008).
Molecular Weight 3089.5
Sequence
(One-Letter Code)
EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence
(Three-Letter Code)
H - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
     
  < Back