Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Neuropeptide  >>  Neuropeptide F

Product Name Neuropeptide F
PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF - NH2
Size 1 mg
Catalog # 60724
US$ $341
Description

Neuropeptide F (NPF), found in Drosophila is a homolog of the mammalian Neuropeptide Y.

Storage -20C
References Ref: Wen, T. et al. Proc. Natl. Acad. Sci. USA 102, 2141 (2005).
Molecular Weight 4593.3
Sequence
(One-Letter Code)
PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2
Sequence
(Three-Letter Code)
H - Pro - Asp - Lys - Asp - Phe - Ile - Val - Asn - Pro - Ser - Asp - Leu - Val - Leu - Asp - Asn - Lys - Ala - Ala - Leu - Arg - Asp - Tyr - Leu - Arg - Gln - Ile - Asn - Glu - Tyr - Phe - Ala - Ile - Ile - Gly - Arg - Pro - Arg - Phe - NH2
     
  < Back