Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Apelin  >>  Apelin-36, human

Product Name Apelin - 36, human
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Size 1 mg
Catalog # 61095
US$ $319
Description

This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Cayabyab, M. et al. J. Virol. 74, 11972 (2000); Reaux-Le Goazigo, A. et al. Endocrinol. 145, 4392 (2004).
Molecular Weight 4195.9
Sequence
(One-Letter Code)
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Sequence
(Three-Letter Code)
H - Leu - Val - Gln - Pro - Arg - Gly - Ser - Arg - Asn - Gly - Pro - Gly - Pro - Trp - Gln - Gly - Gly - Arg - Arg - Lys - Phe - Arg - Arg - Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe - OH
     
  < Back