Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Stay Logged In

Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Cyclic Peptides  >   Disulfide Cyclized Peptides  >>  Elafin

Product Name Elafin
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
Size 0.1 mg
Catalog # 61641
US$ $237
Purity % Peak Area By HPLC ≥ 95%

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.

Detailed Information Datasheet
Storage -20C
References King, A. et al. J. Clin. Endo. Metab. 88, 4426 (2003); Wiedow, O. et al . J. Biol. Chem. 265, 14791 (1990); Wiedow, O. et al. Biochem. Biophys. Res. Commun. 174, 6 (1991); Tremblay, G. et al. Am. J. Respir. Crit. Care Med. 154, 1092 (1996); Simpson, AJ. et al. J. Immunol. 167, 1778 (2001).
Molecular Weight 5999.3
(One-Letter Code)
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
(Three-Letter Code)
H - Ala - Gln - Glu - Pro - Val - Lys - Gly - Pro - Val - Ser - Thr - Lys - Pro - Gly - Ser - Cys - Pro - Ile - Ile - Leu - Ile - Arg - Cys - Ala - Met - Leu - Asn - Pro - Pro - Asn - Arg - Cys - Leu - Lys - Asp - Thr - Asp - Cys - Pro - Gly - Ile - Lys - Lys - Cys - Cys - Glu - Gly - Ser - Cys - Gly - Met - Ala - Cys - Phe - Val - Pro - Gln - OH (Disufide bonds between Cys16 - Cys45, Cys23 - Cys49, Cys32 - Cys44, Cys38 - Cys53)
Product Citations Kuckleburg, CJ. & PJ. Newman. (2013). Neutrophil proteinase 3 acts on protease-activated receptor-2 to enhance vascular endothelial cell barrier function. Arterioscler Thromb Vasc Biol 33, 275. doi: 10.1161/​ATVBAHA.112.300474
  < Back