Peptides  >  Tau Peptides
 Product Size Catalog # US$  
Tau Peptide (45 - 73) (Exon 2/Insert 1 domain)  NEW
ESPLQTPTEDGSEEPGSETSDAKSTPTAE
1 mg AS-65431-1 $58
Tau Peptide (244 - 274) (Repeat 1 domain)  NEW
Ac - QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
1 mg AS-65433-1 $72
Tau Peptide (275 - 305) (Repeat 2 domain)  NEW
VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS
1 mg AS-65434-1 $72
Tau Peptide (306 - 336) (Repeat 3 domain)  NEW
VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
1 mg AS-65435-1 $72
Tau Peptide (337 - 368) (Repeat 4 domain)  NEW
VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
1 mg AS-65436-1 $78
[Ser(OGlcNAc)]400 - KWK - Tau (388 - 411) - KK(Biotin) - NH2  NEW
KWKHGAEIVYKSPVV - S(OGlcNAc) - GDTSPRHLSNVK - K(biotin) - NH2
1 mg AS-65409-1 $385
  < Back