Peptides  >  GPCR Peptide Ligands  >  Calcitonin
 Product Size Catalog # US$  
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
1 mg AS-20673 $137
Calcitonin, human
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP - NH2 (Disulfide bridge: 1 - 7)
5 mg AS-20674 $577
Calcitonin, salmon
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP - NH2 (Disulfide bridge: 1 - 7)
5 mg AS-20678 $484
  < Back