Peptides  >  GPCR Peptide Ligands  >  Galanin
 Product Size Catalog # US$  
Galanin, human
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
1 mg AS-22431 $237
  < Back