Peptides  >  Mitochondrial Peptides
 Product Size Catalog # US$  
Humanin, HN
MAPRGFSCLLLLTSEIDLPVKRRA
1 mg AS-60886 $220
MOTS - c  NEW
H - MRWQEMGYIFYPRKLR - OH
1 mg AS-65587 $149
SHLP1 (Small humanin - like peptide 1)  NEW
H - MCHWAGGASNTGDARGDVFGKQAG - OH
1 mg AS-65588 $381
SHLP3 (Small humanin - like peptide 3)  NEW
H - MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW - OH
0.1 mg AS-65589 $118
SHLP4 (Small humanin - like peptide 4)  NEW
H - MLEVMFLVNRRGKICRVPFTFFNLSL - OH
1 mg AS-65590 $381
SHLP6 (Small humanin - like peptide 6)  NEW
H - MLDQDIPMVQPLLKVRLFND - OH
1 mg AS-65591 $287
  < Back