Peptides  >  Protein Phosphorylation Related Peptides
 Product Size Catalog # US$  
ε - V1 - 2, ε - PKC Inhibitor
EAVSLKPT
1 mg AS-62186 $71
[Ser25] - PKC (19 - 31), biotinylated
K(Biotin) - RFARKGSLRQKNV
1 mg AS-23018 $99
5 - FAM - GRPRTSSFAEG 1 mg AS-60435-1 $247
5 - FAM - KRREILSRRPSYR 1 mg AS-60436-1 $247
5 - FAM - PLSRTLSVSS - NH2 1 mg AS-60515-1 $247
Abltide
KKGEAIYAAPFA - NH2
1 mg AS-61749 $99
Abltide, TAMRA - labeled
5 - TAMRA - KKGEAIYAAPFA - NH2
1 mg AS-61750 $264
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA], Biotinylated
Biotin - ARKRERTYSFGHHA
1 mg AS-29945-1 $143
AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA], Biotinylated
Biotin - ARKRERTYSFGHHA
5 mg AS-29945-5 $572
AMARA peptide
AMARAASAAALARRR
1 mg AS-62596 $93
Aquaporin - 2 (254 - 267), pSER261, human
RQSVELH - pS - PQSLPR
1 mg AS-61328 $127
Autocamtide - 2 [KKALRRQETVDAL]
KKALRRQETVDAL
5 mg AS-60249-5 $330
Bovine - Casein, monophosphopeptide
FQ - pS - EEQQQTEDELQDK
1 mg AS-61146 $159
Casein Kinase 2 (CK2) Substrate α - subunit
RRRDDDSDDD
1 mg AS-60615 $121
Cathepsin D and E FRET Substrate
Mca - GKPILFFRLK(Dnp) - r - NH2
1 mg AS-61793 $143
Cathepsin K substrate
Abz - HPGGPQ - EDDnp
0.1 mg AS-62368 $115
CDK5 Substrate
PKTPKKAKKL
1 mg AS-60026-1 $99
CDK7/9 tide
YSPTSPSYSPTSPSYSPTSPSKKKK
1 mg AS-63367 $198
CREBtide [KRREILSRRPSYR]
KRREILSRRPSYR
5 mg AS-60510-5 $479
CREBtide [KRREILSRRPSYR], 5 - FAM labeled
5 - FAM - KRREILSRRPSYR
5 mg AS-60436-5 $985
CREBtide [KRREILSRRPSYR], Phosphorylated, C - term K
KRREILSRRPS - pY - RK
1 mg AS-27018 $193
Crosstide [GRPRTSSFAEG]
GRPRTSSFAEG
5 mg AS-60209-5 $281
Crosstide [GRPRTSSFAEG], 5 - FAM labeled
5 - FAM - GRPRTSSFAEG
5 mg AS-60435-5 $985
delta PKC (8 - 17); PKC d Inhibitor
SFNSYELGSL
1 mg AS-65111 $66
DNA - PK Substrate
EPPLSQEAFADLWKK
5 mg AS-60210-5 $363
EGF Receptor Substrate 2 [DADE - pY - LIPQQG], 5 - FAM labeled
5 - FAM - DADE - pY - LIPQQG
5 mg AS-29971-5 $1215
EGF Receptor Substrate 2 [DADE - pY - LIPQQG], Biotinylated
Biotin - DADE - pY - LIPQQG
1 mg AS-29972-1 $203
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ]
ADEYLIPQQ
1 mg AS-29942-1 $99
epsilon - V1 - 2, epsilon - PKC Inhibitor, Cys - conjugated
EAVSLKPTC
1 mg AS-62187 $83
ERKtide
ATGPLSPGPFGRR
5 mg AS-60211-5 $313
Erktide
IPTTPITTTYFFFK
1 mg AS-61777 $93
ERMRPRKRQGSVRRRV 1 mg AS-27183 $132
Forkhead derived peptide, Woodtide
KKISGRLSPIMTEQ - NH2
1 mg AS-61743 $105
GSK3 Substrate, a, b subunit
RAAVPPSPSLSRHSSPHQSEDEEE
1 mg AS-60617 $325
HATPPKKKRK
HATPPKKKRK
5 mg AS-60522-5 $479
Histone deacetylase, HDAC substrate
Ac - RGK(Ac) - AMC
1 mg AS-61855 $143
Histone H1 - derived Peptide
GGGPATPKKAKKL
1 mg AS-61761 $83
Histone H1 - derived Peptide, FAM - labeled
5 - FAM - GGGPATPKKAKKL
1 mg AS-61762 $231
Insulin B (9 - 23)
SHLVEALYLVCGERG
1 mg AS-61532 $115
Insulin Receptor (1142 - 1153), pTyr(1146, 1150, 1151)
TRDI - pY - ETD - pY - pY - RK
1 mg AS-20272 $303
Insulin Receptor (1142 - 1153), pTyr1146
TRDI - pY - ETDYYRK
1 mg AS-20292 $247
Insulin Receptor (1142 - 1153), pTyr1150
TRDIYETD - pY - YRK
1 mg AS-20274 $247
IRS1 - derived peptide
KKSRGDYMTMQIG - NH2
1 mg AS-61764 $83
Jak3tide
GGEEEEYFELVKKKK
1 mg AS-62537 $93
Kemptide [LRRASLG]
LRRASLG
5 mg AS-22594 $77
Kemptide [LRRASLG]
LRRASLG
25 mg AS-22595 $303
Kemptide [LRRASLG], 5 - FAM labeled
5 - FAM - LRRASLG
1 mg AS-29933-1 $215
Kemptide [LRRASLG], 5 - FAM labeled
5 - FAM - LRRASLG
5 mg AS-29933-5 $858
Keratin K18 - C
RPVSSAApSVYAGAC
5 mg AS-60214-5 $533
Kinase Substrates Library, Group I, biotinylated, 180 distinct peptide mixtures 1 Set AS-62017-1 $5693
Kinase Substrates Library, Group II, biotinylated, 18 distinct peptide mixtures 1 Set AS-62335 $1711
MBP MAPK Substrate
APRTPGGRR
5 mg AS-27168 $193
MBP, MAPK Substrate, Biotinylated 1 mg AS-60747 $77
MBP, MAPK Substrate, Biotinylated, Phosphorylated
Biotin - APR - pT - PGGRR
1 mg AS-29877 $247
MLC - derived peptide
KKRPQRRYSNVF
1 mg AS-61781 $83
Myristolated PKC Zeta, Pseudosubstrate (ZIP)
Myr - SIYRRGARRWRKL
1 mg AS-63361 $121
Myristolated PKC Zeta, Pseudosubstrate ZIP, Scrambled
Myristoyl - RLYRKRIWRSAGR
1 mg AS-63695 $121
Neurogranin 28 - 43 [AAKIQASFRGHMARKK], Biotinylated - LC
Biotin - LC - AAKIQASFRGHMARKK
5 mg AS-27176 $605
PDKtide
[protein fragment, 39 aa]
1 mg AS-64225 $374
PKG Substrate [RKRSRAE], Glasstide 1 mg AS-60298-1 $88
PKG Substrate [RKRSRAE], Glasstide
RKRSRAE
5 mg AS-60298-5 $352
pp60(v - SRC) Autophosphorylation Site, Phosphorylated
RRLIEDNE - pY - TARG
1 mg AS-22555 $127
Psi - RACK, epsilon - C2/V1 (82 - 92), epsilon PKC (82 - 92), C2 Domain
HDAPIGYD
1 mg AS-62188 $71
RS domain derived peptide
GRSRSRSRSR
1 mg AS-61722 $71
S3 Fragment, ADF/cofilin
MASGVMVSDDVVKVFN
1 mg AS-62637 $99
S6 Kinase Substrate (229 - 239)
AKRRRLSSLRA
1 mg AS-27191 $83
S6 Kinase Substrate (229 - 239)
AKRRRLSSLRA
5 mg AS-27192 $319
S6 Kinase Substrate (229 - 239), Amide, Biotinalyted
Biotin - AKRRRLSSLRA - NH2
1 mg AS-27193 $127
SAMS Peptide
HMRSAMSGLHLVKRR - NH2
5 mg AS-60167-5 $462
Src Optimal Peptide Substrate
AEEEIYGEFEAKKKK
1 mg AS-60222-1 $93
Syntide - 2 [PLARTLSVAGLPGKK]
PLARTLSVAGLPGKK
5 mg AS-22552 $203
Threonine Phosphopeptide,PKC Substrate 4, phosphorylated
KR - pT - IRR
1 mg AS-20291 $181
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK]
KVEKIGEGTYGVVYK
5 mg AS-60551-5 $479
Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], 5 - TMR labeled
5 - TMR - KVEKIGEGTYGVVYK
1 mg AS-29935-1 $352
Tyrosine Kinase Peptide 3 [RRLIEDAE - pY - AARG], Phosphorylated
RRLIEDAE - pY - AARG
1 mg AS-24546 $127
UOM9, PKC Substrate, phosphorylated
KRP - pS - QRHGSKY - NH2
1 mg AS-20294 $215
  < Back